-

nihao guest [ sign in / register ]
2019-12-14 18:37:43


Sequence data of A/chicken/Thailand/Kamphaengphet-3-01/2005(H5N1)
submited by kickingbird at Sep, 3, 2005 14:6 PM from DDBJ

LOCUS       DQ153251                1075 bp    RNA     linear   VRL 29-AUG-2005
DEFINITION  Influenza A virus
            (A/chicken/Thailand/Kamphaengphet-3-01/2005(H5N1)) hemagglutinin
            (HA) gene, partial cds.
ACCESSION   DQ153251
VERSION     DQ153251.1
KEYWORDS    .
SOURCE      Influenza A virus (A/chicken/Thailand/Kamphaengphet-3-01/2005(H5N1))
  ORGANISM  Influenza A virus
            (A/chicken/Thailand/Kamphaengphet-3-01/2005(H5N1))
            Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
            Influenzavirus A.
REFERENCE   1  (bases 1 to 1075)
  AUTHORS   Chamnanpood,P., Chamnanpood,C., Pensuwan,P., Sanguansermsri,D. and
            Sanguansermsri,P.
  TITLE     Characterization of highly pathogenic avian influenza in Thailand
            2005
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1075)
  AUTHORS   Chamnanpood,P., Chamnanpood,C., Pensuwan,P., Sanguansermsri,D. and
            Sanguansermsri,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-AUG-2005) Northern Veterinary Research and
            Development Center (Lower Region), Department of Livestock
            Development, Phitsanulok-Lomsuk, Phitsanulok 65130, Thailand
FEATURES             Location/Qualifiers
     source          1..1075
                     /organism="Influenza A virus
                     (A/chicken/Thailand/Kamphaengphet-3-01/2005(H5N1))"
                     /virion
                     /mol_type="genomic RNA"
                     /strain="A/chicken/Thailand/Kamphaengphet-3-01/2005(H5N1)"
                     /serotype="H5N1"
                     /isolate="Kamphaengphet"
                     /specific_host="chicken"
                     /db_xref="taxon:341916"
                     /lab_host="embryonated egg"
                     /country="Thailand"
                     /note="type: A"
     gene            <1..>1075
                     /gene="HA"
     CDS             <1..>1075
                     /gene="HA"
                     /codon_start=1
                     /product="hemagglutinin"
                     /protein_id="AAZ82496.1"
                     /db_xref="GI:73747138"
                     /translation="KTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSY
                     IVEKANPVNDLCYPGDFNDYEELKHLLSRINHFEKIQIIPKSSWSSHEASLGVSSACP
                     YQGKSSFFRNVVWLIKKNSTYPTIKRSYNNTNQEDLLVLWGIHHPNDATEQTKLYQNP
                     TTYISVGTSTLNQRLIPRIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEY
                     AYKIVKKGDSTIMKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNR
                     LVLATGLRNSPQRERRRKKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADK
                     ESTQKAIDGVTNKVNSIINKMNTQ"
BASE COUNT          380 a          210 c          242 g          243 t
ORIGIN
       1  aagacacaca acgggaagct ctgcgatcta gatggagtaa agcctctaat tttgagagat
      61  tgtagtgtag ctggatggct cctcggaaac ccaatgtgtg acgaattcat caatgtgccg
     121  gaatggtctt acatagtgga gaaggccaat ccagtcaatg acctctgtta cccaggggat
     181  ttcaatgact atgaagaatt gaaacaccta ttgagcagaa taaaccattt tgagaaaatt
     241  cagatcatcc ccaaaagttc ttggtccagt catgaagcct cattaggggt gagctcagca
     301  tgtccatacc agggaaagtc ctcctttttc agaaatgtgg tatggcttat caaaaagaac
     361  agtacatacc caacaataaa gaggagctac aataatacca accaagaaga tcttttggta
     421  ctatggggga ttcaccatcc taatgatgcg acagagcaga caaagctcta tcaaaaccca
     481  accacctata tttccgttgg gacatcaaca ctaaaccaga gattgatacc aagaatagct
     541  actagatcca aagtaaacgg gcaaagtgga aggatggagt tcttctggac aattttaaaa
     601  ccgaatgatg caatcaactt cgagagtaat ggaaatttca ttgctccaga atatgcatac
     661  aaaattgtca agaaagggga ctcaacaatt atgaaaagtg aattggaata tggtaactgc
     721  aacaccaagt gtcaaactcc aatgggggcg ataaactcta gtatgccatt ccacaatata
     781  caccctctca ccatcgggga atgccccaaa tatgtgaaat caaacagatt agttcttgcg
     841  actgggctca gaaatagccc tcaaagagag agaagacgaa aaaagagagg attatttgga
     901  gctatagcag gttttataga gggaggatgg cagggaatgg tagatggttg gtatgggtac
     961  caccatagca atgagcaggg gagtgggtac gctgcagaca aagaatccac tcaaaaggca
    1021  atagatggag tcaccaataa ggtcaactcg ataattaaca aaatgaacac tcagt
//
See Also: Latest news in those days:

[Go Top]    [Close Window]

Related Pages:
Learn about the flu news, articles, events and more
Subscribe to the weekly F.I.C newsletter!


  

Site map  |   Contact us  |  Term of use  |  FAQs
Copyright ©www.flu.org.cn. 2004-2019. All Rights Reserved. Powered by FIC 4.0.1
  Email:webmaster@flu.org.cn